PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00110.1_g00027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 630aa    MW: 68456.1 Da    PI: 6.3943
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00110.1_g00027.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.72.6e-13170231162
                              XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              e++ k+  r+++NRe+A+ sR+RKk+++eeL+ kvk++ +  ++L ++++    e a+l+++
  Rsa1.0_00110.1_g00027.1 170 EEDEKKKVRLIRNRESAQLSRLRKKQYVEELQGKVKSMNSTITELNSKISYVMAENAALRQQ 231
                              67889**********************************************99999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.4E-15164234No hitNo description
SMARTSM003387.8E-16170234IPR004827Basic-leucine zipper domain
PfamPF001707.1E-11171231IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.197172235IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-12174232No hitNo description
CDDcd147045.65E-17178226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006990Biological Processpositive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0009408Biological Processresponse to heat
GO:0005635Cellular Componentnuclear envelope
GO:0005654Cellular Componentnucleoplasm
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016020Cellular Componentmembrane
GO:0048471Cellular Componentperinuclear region of cytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MTESSTFSIA NLPEIPDLNP NMLSDPEMTS FPPLDPFSLS ASDPISDLSA FLDFENDIDF  60
ADLDFDDFFD FNPHAELPVV ISEAIANNDS SEAKNDVVDR GGSEERSDSV HSQVSSQGSK  120
TFASGGGCEA LSSPEKSSVS KSKRKKGDSG GEYRSSKHQK SDASPVEEEE EDEKKKVRLI  180
RNRESAQLSR LRKKQYVEEL QGKVKSMNST ITELNSKISY VMAENAALRQ QMVAASAGAG  240
AGAHPPPPMN PYMAPLPYQW MPYPPPPYPY GSQTTFVPIP KLPLPRCKPN KGESKSKLKK  300
VASISFIGVV FFMFLFGTLV PSMNVNNGGR DSGLSMYEGR RYYDEGRGKV LMVGDGSDVR  360
RESVHSSRDS CGGVEGRLSN SSEPLFASLY VPRNDGLVKI DGNLIIHSVL ASEKAKKNIS  420
ETIKSEEPVL SVPGALSSAL AVPDVRGNGA MLPHSSKALS SGSPDGKRLH QWFHEGGAGT  480
LMDYSMCTEV FQFDISPGAI VPSSVSNITR EHLQNVTTTQ DKRMKNRRIL EGLPVSRLAS  540
ELNNITEAQA SKDAQNKSFH GKANTKQPTS SSSMVVSVLL DPREVVDSET VMPSNPKSLS  600
RIFVVVLLDS VKYVTYSCVL PRSGLHLVAT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00345DAPTransfer from AT3G10800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635480.10.0PREDICTED: bZIP transcription factor 28
SwissprotQ9SG860.0BZP28_ARATH; bZIP transcription factor 28
TrEMBLA0A078FH260.0A0A078FH26_BRANA; BnaA09g24670D protein
STRINGBra023224.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143971822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10800.10.0bZIP family protein